Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Rho-related GTP-binding protein RhoG (RHOG)

Recombinant Human Rho-related GTP-binding protein RhoG (RHOG) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RHOG. Target Synonyms: Rho-related GTP-binding protein RhoG. Accession Number: P84095. Expression Region: 1~188aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Rho-related GTP-binding protein RhoG (RHOG) is a purified Recombinant Protein.

Accession Number

P84095

Expression Region

1~188aa

Host

E. coli

Target

RHOG

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Rho-related GTP-binding protein RhoG

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF366 Human qPCR Primer Pair (NM_152625)
HP217854 200 Reactions

ZNF366 Human qPCR Primer Pair (NM_152625)

Sign In for Pricing
View Details
Eph receptor A3 (EPHA3) (NM_005233) Human Recombinant Protein
TP309191 20 µg

Eph receptor A3 (EPHA3) (NM_005233) Human Recombinant Protein

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details