Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Rho-related GTP-binding protein RhoG (RHOG)

Recombinant Human Rho-related GTP-binding protein RhoG (RHOG) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RHOG. Target Synonyms: Rho-related GTP-binding protein RhoG. Accession Number: P84095. Expression Region: 1~188aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Rho-related GTP-binding protein RhoG (RHOG) is a purified Recombinant Protein.

Accession Number

P84095

Expression Region

1~188aa

Host

E. coli

Target

RHOG

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Rho-related GTP-binding protein RhoG

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary
CB617638 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
4-O-(E)-Feruloylquinic Acid (~90%)
TRC-F308985-5MG 5 mg

4-O-(E)-Feruloylquinic Acid (~90%)

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR560955 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF640R conjugate, 0.1mg/mL
BNC401260-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS701627 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
POLDIP2 Rabbit Polyclonal Antibody
TA380122 100 µL

POLDIP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details