Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial

Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ZNRF3. Target Synonyms: RING finger protein 203Zinc/RING finger protein 3. Accession Number: Q9ULT6. Expression Region: 56~219aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 23.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial is a purified Recombinant Protein.

Accession Number

Q9ULT6

Expression Region

56~219aa

Host

Baculovirus

Target

ZNRF3

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

RING finger protein 203Zinc/RING finger protein 3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nlrp2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3162702 1.0 µg DNA

Nlrp2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Phospho-TGF beta Receptor II (Ser225) Rabbit Polyclonal Antibody
orb783033-01 50 μL

Phospho-TGF beta Receptor II (Ser225) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-TGF beta Receptor II (Ser225) Rabbit Polyclonal Antibody
orb783033-02 100 µL

Phospho-TGF beta Receptor II (Ser225) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-TGF beta Receptor II (Ser225) Rabbit Polyclonal Antibody
orb783033-03 200 µL

Phospho-TGF beta Receptor II (Ser225) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KLHDC10 Protein Vector (Human) (pPM-C-HA)
PV089232 500 ng

KLHDC10 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Ncor2 shRNA (UAS) - Lentiviral mouseNcor2 shRNA (UAS, GFP) (25)
GTR15220424 1 Vial

Lentiviral mouse Ncor2 shRNA (UAS) - Lentiviral mouseNcor2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details