Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT)

Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: QPCT. Target Synonyms: Glutaminyl cyclase; QC; sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase; EC. Accession Number: Q16769. Expression Region: 29~361aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 40.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT) is a purified Recombinant Protein.

Accession Number

Q16769

Expression Region

29~361aa

Host

Yeast

Target

QPCT

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glutaminyl cyclase; QC; sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase; EC

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 Ubiquitin Protein Ligase LRSAM1 (LRSAM1) Antibody
abx322546-01 20 µL

E3 Ubiquitin Protein Ligase LRSAM1 (LRSAM1) Antibody

Sign In for Pricing
View Details
E3 Ubiquitin Protein Ligase LRSAM1 (LRSAM1) Antibody
abx322546-02 50 µL

E3 Ubiquitin Protein Ligase LRSAM1 (LRSAM1) Antibody

Sign In for Pricing
View Details
E3 Ubiquitin Protein Ligase LRSAM1 (LRSAM1) Antibody
abx322546-03 100 µL

E3 Ubiquitin Protein Ligase LRSAM1 (LRSAM1) Antibody

Sign In for Pricing
View Details
E3 Ubiquitin Protein Ligase LRSAM1 (LRSAM1) Antibody
abx322546-04 200 µL

E3 Ubiquitin Protein Ligase LRSAM1 (LRSAM1) Antibody

Sign In for Pricing
View Details
E3 Ubiquitin Protein Ligase LRSAM1 (LRSAM1) Antibody
abx322546-05 1 mL

E3 Ubiquitin Protein Ligase LRSAM1 (LRSAM1) Antibody

Sign In for Pricing
View Details
CA6, CT (CA6, Carbonic anhydrase 6, Carbonate dehydratase VI, Carbonic anhydrase VI, Salivary carbonic anhydrase, Secreted carbonic anhydrase) (AP)
MBS6280254-01 0.2 mL

CA6, CT (CA6, Carbonic anhydrase 6, Carbonate dehydratase VI, Carbonic anhydrase VI, Salivary carbonic anhydrase, Secreted carbonic anhydrase) (AP)

Sign In for Pricing
View Details