Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial

Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HLA-A. Target Synonyms: MHC class I antigen A*1HLAA. Accession Number: P30443. Expression Region: 25~308aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 40.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial is a purified Recombinant Protein.

Accession Number

P30443

Expression Region

25~308aa

Host

E. coli

Target

HLA-A

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MHC class I antigen A*1HLAA

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC152 (NM_001134848) Human Over-expression Lysate
E45H02024-2 20 µg

CCDC152 (NM_001134848) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Anti Human SLC17A6 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)
MBS8424719-01 0.12 mL

Rabbit Anti Human SLC17A6 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti Human SLC17A6 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)
MBS8424719-02 0.2 mL

Rabbit Anti Human SLC17A6 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti Human SLC17A6 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)
MBS8424719-03 5x 0.2 mL

Rabbit Anti Human SLC17A6 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Immunofluorescence)

Sign In for Pricing
View Details
Lentiviral human GRID2 shRNA (UAS) - Lentiviral human GRID2 shRNA (UAS, GFP) (100)
GTR15334656 1 Vial

Lentiviral human GRID2 shRNA (UAS) - Lentiviral human GRID2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Lentiviral human TAL1 shRNA (UAS) - Lentiviral human TAL1 shRNA (UAS) (25)
GTR15331232 1 Vial

Lentiviral human TAL1 shRNA (UAS) - Lentiviral human TAL1 shRNA (UAS) (25)

Sign In for Pricing
View Details