Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial

Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HLA-A. Target Synonyms: MHC class I antigen A*1HLAA. Accession Number: P30443. Expression Region: 25~308aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 40.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial is a purified Recombinant Protein.

Accession Number

P30443

Expression Region

25~308aa

Host

E. coli

Target

HLA-A

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

40.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

MHC class I antigen A*1HLAA

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASSF1a Mouse mAb
F2337-100uL*2 2x 100 μL

RASSF1a Mouse mAb

Sign In for Pricing
View Details
Monkey Olfactory receptor 13C9 (OR13C9) ELISA Kit
GTR10366349 96 Well

Monkey Olfactory receptor 13C9 (OR13C9) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human RHBDL1 shRNA (UAS) - Lentiviral human RHBDL1 shRNA (UAS) plasmid
GTR15113563 1 Vial

Lentiviral human RHBDL1 shRNA (UAS) - Lentiviral human RHBDL1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Tmem147 siRNA Oligos set (Mouse)
46904174 3x 5 nmol

Tmem147 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant human RELT Protein (HEK293)
orb2328596-01 20 µg

Recombinant human RELT Protein (HEK293)

Sign In for Pricing
View Details
Recombinant human RELT Protein (HEK293)
orb2328596-02 50 µg

Recombinant human RELT Protein (HEK293)

Sign In for Pricing
View Details