Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Disco-interacting protein 2 homolog C (DIP2C), partial

Recombinant Human Disco-interacting protein 2 homolog C (DIP2C), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: DIP2C. Target Synonyms: DIP2 homolog C. Accession Number: Q9Y2E4. Expression Region: 1~125aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 19kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Disco-interacting protein 2 homolog C (DIP2C), partial is a purified Recombinant Protein.

Accession Number

Q9Y2E4

Expression Region

1~125aa

Host

Baculovirus

Target

DIP2C

Conjugation

Unconjugated

Tag

C-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

DIP2 homolog C

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MADRSLEGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKERKMAVPMPSKRRSLVVQTSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Family With Sequence Similarity 127, Member B (FAM127A) Antibody
abx303808-01 20 µg

Family With Sequence Similarity 127, Member B (FAM127A) Antibody

Sign In for Pricing
View Details
Family With Sequence Similarity 127, Member B (FAM127A) Antibody
abx303808-02 50 µg

Family With Sequence Similarity 127, Member B (FAM127A) Antibody

Sign In for Pricing
View Details
Family With Sequence Similarity 127, Member B (FAM127A) Antibody
abx303808-03 100 µg

Family With Sequence Similarity 127, Member B (FAM127A) Antibody

Sign In for Pricing
View Details
Family With Sequence Similarity 127, Member B (FAM127A) Antibody
abx303808-04 200 µg

Family With Sequence Similarity 127, Member B (FAM127A) Antibody

Sign In for Pricing
View Details
Family With Sequence Similarity 127, Member B (FAM127A) Antibody
abx303808-05 1 mg

Family With Sequence Similarity 127, Member B (FAM127A) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Sergef shRNA (UAS) - Lentiviral mouse Sergef shRNA (UAS, RFP) (25)
GTR15179087 1 Vial

Lentiviral mouse Sergef shRNA (UAS) - Lentiviral mouse Sergef shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details