Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 2 (CXCL2)

Recombinant Human C-X-C motif chemokine 2 (CXCL2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CXCL2. Target Synonyms: Growth-regulated protein beta; Gro-beta; Macrophage inflammatory protein 2-alpha; MIP2-alpha. Accession Number: P19875. Expression Region: 35~107aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human C-X-C motif chemokine 2 (CXCL2) is a purified Recombinant Protein.

Accession Number

P19875

Expression Region

35~107aa

Host

E. coli

Target

CXCL2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Growth-regulated protein beta; Gro-beta; Macrophage inflammatory protein 2-alpha; MIP2-alpha

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxypeptidase B Antibody
DF9338-01 100 µL

Carboxypeptidase B Antibody

Sign In for Pricing
View Details
Carboxypeptidase B Antibody
DF9338-02 200 µL

Carboxypeptidase B Antibody

Sign In for Pricing
View Details
Recombinant Human Phosphatidylinositol Transfer Protein, Beta
32-4462-25 25 µg

Recombinant Human Phosphatidylinositol Transfer Protein, Beta

Sign In for Pricing
View Details
GLS Protein Vector (Human) (pPM-C-His)
PV080824 500 ng

GLS Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Map2k6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7092206 1.0 µg DNA

Map2k6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Ifih1 3'UTR GFP Stable Cell Line
TU256108 1.0 mL

Ifih1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details