Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 2 (CXCL2)

Recombinant Human C-X-C motif chemokine 2 (CXCL2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CXCL2. Target Synonyms: Growth-regulated protein beta; Gro-beta; Macrophage inflammatory protein 2-alpha; MIP2-alpha. Accession Number: P19875. Expression Region: 35~107aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human C-X-C motif chemokine 2 (CXCL2) is a purified Recombinant Protein.

Accession Number

P19875

Expression Region

35~107aa

Host

E. coli

Target

CXCL2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Growth-regulated protein beta; Gro-beta; Macrophage inflammatory protein 2-alpha; MIP2-alpha

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CYB5 ELISA Kit
E102339 1 Each

Human CYB5 ELISA Kit

Sign In for Pricing
View Details
FAS (Factor Related Apoptosis) BioAssayTM ELISA Kit (Mouse) discontinued
355581-01 48 Tests

FAS (Factor Related Apoptosis) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
FAS (Factor Related Apoptosis) BioAssayTM ELISA Kit (Mouse) discontinued
355581-02 96 Tests

FAS (Factor Related Apoptosis) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
E2F1 Antibody - middle region : FITC (ARP31171_P050-FITC)
ARP31171_P050-FITC 100 µL

E2F1 Antibody - middle region : FITC (ARP31171_P050-FITC)

Sign In for Pricing
View Details
ISO20560PM-220X210-AZOTE LIQUIDE Pipe Markers for Gases
319438 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-220X210-AZOTE LIQUIDE Pipe Markers for Gases

Sign In for Pricing
View Details
PCDHGC5 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-11161R-BF488 100 µL

PCDHGC5 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details