Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine protease inhibitor Kazal-type 1 (SPINK1), partial

Recombinant Human Serine protease inhibitor Kazal-type 1 (SPINK1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SPINK1. Target Synonyms: Pancreatic secretory trypsin inhibitor; Tumor-associated trypsin inhibitor; TATI. Accession Number: P00995. Expression Region: 19~79aa. Tag Info: N-Terminal 6Xhis-Gst-Tagged. Theoretical MW: 38.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Serine protease inhibitor Kazal-type 1 (SPINK1), partial is a purified Recombinant Protein.

Accession Number

P00995

Expression Region

19~79aa

Host

E. coli

Target

SPINK1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Gst-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Pancreatic secretory trypsin inhibitor; Tumor-associated trypsin inhibitor; TATI

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque SNAI2 Protein, His (Fc)-Avi-tagged
SNAI2-4171R 50 µg

Recombinant Rhesus Macaque SNAI2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Bovine Vacuolar protein sorting-associated protein 37A (VPS37A) ELISA Kit
EIA07083Bo 1 Kit

Bovine Vacuolar protein sorting-associated protein 37A (VPS37A) ELISA Kit

Sign In for Pricing
View Details
Human TPSB2 Pre-designed siRNA Set A
SI017231A 1 Each

Human TPSB2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Pax5 (Paired Box 5, Paired Box Homeotic Gene 5, Paired Box Protein Pax-5, Pax-5, B cell Lineage Specific Activator Protein, B cell Specific Transcription Factor, BSAP) discontinued
P3113-83W 100 µg

Pax5 (Paired Box 5, Paired Box Homeotic Gene 5, Paired Box Protein Pax-5, Pax-5, B cell Lineage Specific Activator Protein, B cell Specific Transcription Factor, BSAP) discontinued

Sign In for Pricing
View Details
Recombinant Human TAGLN protein
MBS1561389-01 0.05 mg

Recombinant Human TAGLN protein

Sign In for Pricing
View Details
Recombinant Human TAGLN protein
MBS1561389-02 0.1 mg

Recombinant Human TAGLN protein

Sign In for Pricing
View Details