Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine protease inhibitor Kazal-type 1 (SPINK1), partial

Recombinant Human Serine protease inhibitor Kazal-type 1 (SPINK1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SPINK1. Target Synonyms: Pancreatic secretory trypsin inhibitor; Tumor-associated trypsin inhibitor; TATI. Accession Number: P00995. Expression Region: 19~79aa. Tag Info: N-Terminal 6Xhis-Gst-Tagged. Theoretical MW: 38.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Serine protease inhibitor Kazal-type 1 (SPINK1), partial is a purified Recombinant Protein.

Accession Number

P00995

Expression Region

19~79aa

Host

E. coli

Target

SPINK1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Gst-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

38.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Pancreatic secretory trypsin inhibitor; Tumor-associated trypsin inhibitor; TATI

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK5RAP1 Protein Vector (Rat) (pPM-C-His)
PV259113 500 ng

CDK5RAP1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
LYRM2, NT (LYRM2, LYR motif-containing protein 2) (PE) discontinued
038032-PE 200 µL

LYRM2, NT (LYRM2, LYR motif-containing protein 2) (PE) discontinued

Sign In for Pricing
View Details
Iris Scissor, Straight
43200012-2 5 Each

Iris Scissor, Straight

Sign In for Pricing
View Details
EFCAB2 (NM_001143943) Human Over-expression Lysate
LH01604V 100 µg

EFCAB2 (NM_001143943) Human Over-expression Lysate

Sign In for Pricing
View Details
IGHV1OR16-1 3'UTR Luciferase Stable Cell Line
TU010630 1.0 mL

IGHV1OR16-1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Zinc finger matrin-type protein 3 (ZMAT3) ELISA Kit
CK-bio-14023-01 48 Tests

Human Zinc finger matrin-type protein 3 (ZMAT3) ELISA Kit

Sign In for Pricing
View Details