Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aminopeptidase N (ANPEP), partial

Recombinant Human Aminopeptidase N (ANPEP), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: ANPEP. Target Synonyms: AP-N; hAPN; Alanyl aminopeptidase; Aminopeptidase M; AP-M; Microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; gp150; CD13. Accession Number: P15144. Expression Region: 34~219aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 55.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Aminopeptidase N (ANPEP), partial is a purified Recombinant Protein.

Accession Number

P15144

Expression Region

34~219aa

Host

E. coli

Target

ANPEP

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

55.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

AP-N; hAPN; Alanyl aminopeptidase; Aminopeptidase M; AP-M; Microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; gp150; CD13

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CSK Rabbit Monoclonal Antibody, Carrier-free
M00799-2-carrier-free 100 µL

Anti-CSK Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Rabl2 (NM_026817) Mouse Untagged Clone
MC210780 10 µg

Rabl2 (NM_026817) Mouse Untagged Clone

Sign In for Pricing
View Details
1H-Pyrrolo[3,2-b]pyridine-6-boronic acid, pinacol ester
OR361597-01 100 mg

1H-Pyrrolo[3,2-b]pyridine-6-boronic acid, pinacol ester

Sign In for Pricing
View Details
1H-Pyrrolo[3,2-b]pyridine-6-boronic acid, pinacol ester
OR361597-02 250 mg

1H-Pyrrolo[3,2-b]pyridine-6-boronic acid, pinacol ester

Sign In for Pricing
View Details
Lentiviral human NIPBL shRNA (UAS) - Lentiviral human NIPBL shRNA (UAS, GFP) (100)
GTR15315552 1 Vial

Lentiviral human NIPBL shRNA (UAS) - Lentiviral human NIPBL shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human Microtubule Associated Protein 1 Light Chain 3 Alpha ELISA Kit
MBS060714-01 48 Well

Human Microtubule Associated Protein 1 Light Chain 3 Alpha ELISA Kit

Sign In for Pricing
View Details