Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phospholipid hydroperoxide glutathione peroxidase (GPX4) (U73S), partial

Recombinant Human Phospholipid hydroperoxide glutathione peroxidase (GPX4) (U73S), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GPX4. Target Synonyms: PHGPx; Glutathione peroxidase 4; GPx-4; GSHPx-4. Accession Number: P36969. Expression Region: 29~197aa (U73S) . Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Phospholipid hydroperoxide glutathione peroxidase (GPX4) (U73S), partial is a purified Recombinant Protein.

Accession Number

P36969

Expression Region

29~197aa (U73S)

Host

E. coli

Target

GPX4

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PHGPx; Glutathione peroxidase 4; GPx-4; GSHPx-4

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQSGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Palivizumab ELISA Kit
E55K0661 96 Tests

Anti-Palivizumab ELISA Kit

Sign In for Pricing
View Details
RBM16 (SCAF8) (NM_014892) Human Untagged Clone
SC114740 10 µg

RBM16 (SCAF8) (NM_014892) Human Untagged Clone

Sign In for Pricing
View Details
Rat Selenoprotein P1, Plasma (SEPP1) ELISA Kit
RD-SEPP1-Ra-96Tests 96 Tests

Rat Selenoprotein P1, Plasma (SEPP1) ELISA Kit

Sign In for Pricing
View Details
IL-7 (Interleukin 7) BioAssayTM ELISA Kit (Rat) discontinued
383455 96 Tests

IL-7 (Interleukin 7) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) NDK Polyclonal Antibody
MBS7140808 Inquire

Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) NDK Polyclonal Antibody

Sign In for Pricing
View Details
Cdkn2aip sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3212708 1.0 µg DNA

Cdkn2aip sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details