Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Phospholipid hydroperoxide glutathione peroxidase (GPX4) (U73S), partial

Recombinant Human Phospholipid hydroperoxide glutathione peroxidase (GPX4) (U73S), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GPX4. Target Synonyms: PHGPx; Glutathione peroxidase 4; GPx-4; GSHPx-4. Accession Number: P36969. Expression Region: 29~197aa (U73S) . Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Phospholipid hydroperoxide glutathione peroxidase (GPX4) (U73S), partial is a purified Recombinant Protein.

Accession Number

P36969

Expression Region

29~197aa (U73S)

Host

E. coli

Target

GPX4

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PHGPx; Glutathione peroxidase 4; GPx-4; GSHPx-4

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQSGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vanadium carbide
GX7849-50g 50 g

Vanadium carbide

Sign In for Pricing
View Details
Abelson Tyrosine-Protein Kinase 2 (ABL2) Antibody
abx145254-01 100 µg

Abelson Tyrosine-Protein Kinase 2 (ABL2) Antibody

Sign In for Pricing
View Details
Abelson Tyrosine-Protein Kinase 2 (ABL2) Antibody
abx145254-02 1 mg

Abelson Tyrosine-Protein Kinase 2 (ABL2) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Sra1 shRNA (UAS) - Lentiviral mouse Sra1 shRNA (UAS, iRFP) (100)
GTR15207687 1 Vial

Lentiviral mouse Sra1 shRNA (UAS) - Lentiviral mouse Sra1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rat Brain Natriuretic Peptide 32 (BNP-32) AssayLite™ Antibody (FITC Conjugate)
10541-05041 2x 75 µg

Rat Brain Natriuretic Peptide 32 (BNP-32) AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Tmem199 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4992003 1.0 µg DNA

Tmem199 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details