Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rattus norvegicus polyomavirus 2 Major capsid protein VP1 (RatPyV2_gp1)

Recombinant Rattus norvegicus polyomavirus 2 Major capsid protein VP1 (RatPyV2_gp1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rattus norvegicus polyomavirus 2. Target Name: RatPyV2_gp1. Target Synonyms: Major structural protein VP1. Accession Number: A0A2Z2DSF0. Expression Region: 1~344aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 44.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rattus norvegicus polyomavirus 2 Major capsid protein VP1 (RatPyV2_gp1) is a purified Recombinant Protein.

Accession Number

A0A2Z2DSF0

Expression Region

1~344aa

Host

E. coli

Target

RatPyV2_gp1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

44.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Major structural protein VP1

Species

Rattus norvegicus polyomavirus 2

Protein Name

Recombinant Protein

AA Sequence

MSRVTCQRKRLGPGRAPVQKLPRVIKKGGVEVLATVPPGPESEYKLEMFLKPCFGNDSGQAGPHYWNHSSPFTGEALTDGDYHVCYSMGQIQLPEISDQCSEEYMVVWECYRMETEVLYTPKITAAGLSGSNFLAVQGTQMYFWAVGGEPLDVMYMLPKEKMKPQGNLRAPSTTHSVYDPNIIREKLSSELYPVEYWTPDPSRNENTRYFGRIVGGAATPPVVTYSNSSTIPLLDENGVGVLCNQQRCYVTCADITGFLHNRIETAHGRFFRLHFRQRRVKNPYTMSLLYKQVLIQRPPQVAAQLGVTEVTIEEGQAPAPVMAQVGSCEPMITQQASSMLNVQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-500 1x 500 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-100 1x 100 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF640R conjugate, 0.1mg/mL
BNC402035-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e, Mouse (145-2C11), CF568 conjugate, 0.1mg/mL
BNC682013-500 1x 500 µL

CD3e, Mouse (145-2C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF488A conjugate, 0.1mg/mL
BNC882408-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details