Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant E. coli Colicin-E5 (col), partial

Recombinant E. coli Colicin-E5 (col), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: E. coli. Target Name: col. Accession Number: P18000. Expression Region: 74~180aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 24.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant E. coli Colicin-E5 (col), partial is a purified Recombinant Protein.

Accession Number

P18000

Expression Region

74~180aa

Host

E. coli

Target

Col

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

E. coli

Protein Name

Recombinant Protein

AA Sequence

LAKNKGKIPGLKIDQKIRGQMPERGWTEDDIKNTVSNGATGTSFDKRSPKKTPPDYLGRNDPATVYGSPGKYVVVNDRTGEVTQISDKTDPGWVDDSRIQWGNKNDQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dhrs3 antibody - middle region (ARP46495_P050)
ARP46495_P050 100 µL

Dhrs3 antibody - middle region (ARP46495_P050)

Sign In for Pricing
View Details
RAB7A 3'UTR Lenti-reporter-Luc Vector
38361081 1.0 µg

RAB7A 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
GCN5L2 (Histone Acetyltransferase KAT2A, Lysine Acetyltransferase 2A, Histone Acetyltransferase GCN5, hsGCN5, STAF97, GCN5L2, General Control Of Amino Acid Synthesis Protein 5-like 2, STAF97, HGCN5) (FITC)
MBS6147352-01 0.1 mL

GCN5L2 (Histone Acetyltransferase KAT2A, Lysine Acetyltransferase 2A, Histone Acetyltransferase GCN5, hsGCN5, STAF97, GCN5L2, General Control Of Amino Acid Synthesis Protein 5-like 2, STAF97, HGCN5) (FITC)

Sign In for Pricing
View Details
GCN5L2 (Histone Acetyltransferase KAT2A, Lysine Acetyltransferase 2A, Histone Acetyltransferase GCN5, hsGCN5, STAF97, GCN5L2, General Control Of Amino Acid Synthesis Protein 5-like 2, STAF97, HGCN5) (FITC)
MBS6147352-02 5x 0.1 mL

GCN5L2 (Histone Acetyltransferase KAT2A, Lysine Acetyltransferase 2A, Histone Acetyltransferase GCN5, hsGCN5, STAF97, GCN5L2, General Control Of Amino Acid Synthesis Protein 5-like 2, STAF97, HGCN5) (FITC)

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae rplV Protein (aa 1-110)
VAng-Lsx07142-50gEcoli 50 µg (E. coli)

Recombinant Shigella Dysenteriae rplV Protein (aa 1-110)

Sign In for Pricing
View Details
JAKMIP1 Rabbit pAb
E45R20236N-50-2 50 µL

JAKMIP1 Rabbit pAb

Sign In for Pricing
View Details