Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fin bud initiation factor homolog (Fibin)

Recombinant Mouse Fin bud initiation factor homolog (Fibin) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Fibin. Accession Number: Q9CQS3. Expression Region: 19~217aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Fin bud initiation factor homolog (Fibin) is a purified Recombinant Protein.

Accession Number

Q9CQS3

Expression Region

19~217aa

Host

Baculovirus

Target

Fibin

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

YFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDRRRCSQGEGGQASSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLAHTIRSHGTRLGRLKSDYLEGGAQKTG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sil1 shRNA (UAS) - Lentiviral mouse Sil1 shRNA (UAS, RFP) (100)
GTR15266580 1 Vial

Lentiviral mouse Sil1 shRNA (UAS) - Lentiviral mouse Sil1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Mouse Monoclonal ZC3H7A Antibody (PCRP-ZC3H7A-1D6) [PE]
NBP3-14047PE 0.1 mL

Mouse Monoclonal ZC3H7A Antibody (PCRP-ZC3H7A-1D6) [PE]

Sign In for Pricing
View Details
EBP, CT (EBP, 3-beta-hydroxysteroid-Delta (8), Delta (7) -isomerase, Cholestenol Delta-isomerase, Delta (8) -Delta (7) sterol isomerase, Emopamil-binding protein) (AP) discontinued
034898-AP 200 µL

EBP, CT (EBP, 3-beta-hydroxysteroid-Delta (8), Delta (7) -isomerase, Cholestenol Delta-isomerase, Delta (8) -Delta (7) sterol isomerase, Emopamil-binding protein) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Mouse SPOCK3 protein (C-6His)
CD00215-01 10 µg

Recombinant Mouse SPOCK3 protein (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse SPOCK3 protein (C-6His)
CD00215-02 50 µg

Recombinant Mouse SPOCK3 protein (C-6His)

Sign In for Pricing
View Details
Lentiviral mouse Mid2 shRNA (UAS) - Lentiviral mouse Mid2 shRNA (UAS, RFP) plasmid
GTR15179101 1 Vial

Lentiviral mouse Mid2 shRNA (UAS) - Lentiviral mouse Mid2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details