Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 11 Protein E7 (E7)

Recombinant Human papillomavirus type 11 Protein E7 (E7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human papillomavirus type 11. Target Name: E7. Accession Number: P04020. Expression Region: 1~98aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human papillomavirus type 11 Protein E7 (E7) is a purified Recombinant Protein.

Accession Number

P04020

Expression Region

1~98aa

Host

E. coli

Target

E7

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human papillomavirus 11

Protein Name

Recombinant Protein

AA Sequence

MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSPP1 CRISPRa sgRNA lentivector (set of three targets)(Human)
16961121 3x 1.0µg DNA

CSPP1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
MAPK13 Antibody, Biotin conjugated
MBS1496503-01 0.05 mg

MAPK13 Antibody, Biotin conjugated

Sign In for Pricing
View Details
MAPK13 Antibody, Biotin conjugated
MBS1496503-02 0.1 mg

MAPK13 Antibody, Biotin conjugated

Sign In for Pricing
View Details
MAPK13 Antibody, Biotin conjugated
MBS1496503-03 5x 0.1 mg

MAPK13 Antibody, Biotin conjugated

Sign In for Pricing
View Details
RCN2 (NM_002902) Human Tagged ORF Clone
RG200429 10 µg

RCN2 (NM_002902) Human Tagged ORF Clone

Sign In for Pricing
View Details
PTCH2 (NM_003738) Human Tagged ORF Clone Lentiviral Particle
RC224642L4V 200 µL

PTCH2 (NM_003738) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details