Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 11 Protein E7 (E7)

Recombinant Human papillomavirus type 11 Protein E7 (E7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human papillomavirus type 11. Target Name: E7. Accession Number: P04020. Expression Region: 1~98aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human papillomavirus type 11 Protein E7 (E7) is a purified Recombinant Protein.

Accession Number

P04020

Expression Region

1~98aa

Host

E. coli

Target

E7

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human papillomavirus 11

Protein Name

Recombinant Protein

AA Sequence

MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arhgap24 Rat shRNA Plasmid (Locus ID 305156)
TL701542 1 Kit

Arhgap24 Rat shRNA Plasmid (Locus ID 305156)

Sign In for Pricing
View Details
SRRD sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2287808 1.0 µg DNA

SRRD sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Non Metastatic Cells 5, Protein NM23A Expressed In (NME5) Antibody
abx129841-01 100 µL

Non Metastatic Cells 5, Protein NM23A Expressed In (NME5) Antibody

Sign In for Pricing
View Details
Non Metastatic Cells 5, Protein NM23A Expressed In (NME5) Antibody
abx129841-02 200 µL

Non Metastatic Cells 5, Protein NM23A Expressed In (NME5) Antibody

Sign In for Pricing
View Details
Non Metastatic Cells 5, Protein NM23A Expressed In (NME5) Antibody
abx129841-03 1 mL

Non Metastatic Cells 5, Protein NM23A Expressed In (NME5) Antibody

Sign In for Pricing
View Details
KNDC1 Antibody - C-terminal region
ARP60888_P050-25UL 25 µL

KNDC1 Antibody - C-terminal region

Sign In for Pricing
View Details