Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TNFRSF17. Target Synonyms: B-cell maturation protein. Accession Number: Q02223. Expression Region: 1~54aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 10.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial is a purified Recombinant Protein.

Accession Number

Q02223

Expression Region

1~54aa

Host

E. coli

Target

TNFRSF17

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

B-cell maturation protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-100 1x 100 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF640R conjugate, 0.1mg/mL
BNC402886-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF488A conjugate, 0.1mg/mL
BNC882276-500 1x 500 µL

CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (KRTH/1076), CF740 conjugate, 0.1mg/mL
BNC741076-100 1x 100 µL

Cytokeratin, HMW (KRTH/1076), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/468 + C8/144B), CF568 conjugate, 0.1mg/mL
BNC680750-500 1x 500 µL

CD8 (C8/468 + C8/144B), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tenascin (T2H5), CF488A conjugate, 0.1mg/mL
BNC880392-100 1x 100 µL

Tenascin (T2H5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details