Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fin bud initiation factor homolog (Fibin)

Recombinant Mouse Fin bud initiation factor homolog (Fibin) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Fibin. Accession Number: Q9CQS3. Expression Region: 19~217aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Fin bud initiation factor homolog (Fibin) is a purified Recombinant Protein.

Accession Number

Q9CQS3

Expression Region

19~217aa

Host

E. coli

Target

Fibin

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

YFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDRRRCSQGEGGQASSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLAHTIRSHGTRLGRLKSDYLEGGAQKTG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnfsf12 Mouse shRNA Plasmid (Locus ID 21944)
TL502303 1 Kit

Tnfsf12 Mouse shRNA Plasmid (Locus ID 21944)

Sign In for Pricing
View Details
Human UNC5D siRNA
abx939045-01 15 nmol

Human UNC5D siRNA

Sign In for Pricing
View Details
Human UNC5D siRNA
abx939045-02 30 nmol

Human UNC5D siRNA

Sign In for Pricing
View Details
Human hsa-miR-5572 miRNA Antagomir
abx887035-01 10 nmol

Human hsa-miR-5572 miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-5572 miRNA Antagomir
abx887035-02 20 nmol

Human hsa-miR-5572 miRNA Antagomir

Sign In for Pricing
View Details
CXCL5 (NM_002994) Human Recombinant Protein
TP302707L 1 mg

CXCL5 (NM_002994) Human Recombinant Protein

Sign In for Pricing
View Details