Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY)

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage T4 (Bacteriophage T4) . Target Name: uvsY. Accession Number: P04537. Expression Region: 1~137aa. Tag Info: N-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 21.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY) is a purified Recombinant Protein.

Accession Number

P04537

Expression Region

1~137aa

Host

E. coli

Target

UvsY

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Avi-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Enterobacteria phage T4 (Bacteriophage T4)

Protein Name

Recombinant Protein

AA Sequence

MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCRNA00112 CRISPRa sgRNA lentivector (set of three targets)(Human)
62548121 3x 1.0µg DNA

NCRNA00112 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Rabbit Monoclonal BID Antibody (005) [PE]
NBP2-89516PE 0.1 mL

Rabbit Monoclonal BID Antibody (005) [PE]

Sign In for Pricing
View Details
TRIM29 Recombinant Protein Antigen
NBP3-17646PEP 100 µL

TRIM29 Recombinant Protein Antigen

Sign In for Pricing
View Details
CLCC1 (NM_001048210) Human Recombinant Protein
TP313260L 1 mg

CLCC1 (NM_001048210) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Src shRNA (UAS) - Lentiviral mouse Src shRNA (UAS, iRFP) plasmid
GTR15178744 1 Vial

Lentiviral mouse Src shRNA (UAS) - Lentiviral mouse Src shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Cxcl14 3'UTR GFP Stable Cell Line
TU252991 1.0 mL

Cxcl14 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details