Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY)

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage T4 (Bacteriophage T4) . Target Name: uvsY. Accession Number: P04537. Expression Region: 1~137aa. Tag Info: N-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 21.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY) is a purified Recombinant Protein.

Accession Number

P04537

Expression Region

1~137aa

Host

E. coli

Target

UvsY

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Avi-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Enterobacteria phage T4 (Bacteriophage T4)

Protein Name

Recombinant Protein

AA Sequence

MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-517-5p miRNA Antagomir
MNH02872 2x 5.0 nmol

hsa-miR-517-5p miRNA Antagomir

Sign In for Pricing
View Details
LRCH3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-9329R-BF750 100 µL

LRCH3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal IFN-alpha G/IFNA5 Antibody (102) [Alexa Fluor 700]
NBP2-89436AF700 0.1 mL

Rabbit Monoclonal IFN-alpha G/IFNA5 Antibody (102) [Alexa Fluor 700]

Sign In for Pricing
View Details
Sheep anti Human IgE
40-IG11 1 ml

Sheep anti Human IgE

Sign In for Pricing
View Details
RGD1561226 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6027305 3x 1.0 µg

RGD1561226 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
BAIAP1 (MAGI1, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 1, BAI1-associated Protein 1, BAP-1, Membrane-associated Guanylate Kinase Inverted 1, MAGI-1, Atrophin-1-interacting Protein 3, AIP-3, WW Domain-containing Protein 3
MBS6151389-01 0.1 mL

BAIAP1 (MAGI1, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 1, BAI1-associated Protein 1, BAP-1, Membrane-associated Guanylate Kinase Inverted 1, MAGI-1, Atrophin-1-interacting Protein 3, AIP-3, WW Domain-containing Protein 3

Sign In for Pricing
View Details