Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY)

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage T4 (Bacteriophage T4) . Target Name: uvsY. Accession Number: P04537. Expression Region: 1~137aa. Tag Info: N-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 21.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY) is a purified Recombinant Protein.

Accession Number

P04537

Expression Region

1~137aa

Host

E. coli

Target

UvsY

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Avi-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Enterobacteria phage T4 (Bacteriophage T4)

Protein Name

Recombinant Protein

AA Sequence

MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Opsin-5 (OPN5) Human ELISA Kit
F5854 96 Tests

Opsin-5 (OPN5) Human ELISA Kit

Sign In for Pricing
View Details
Ghrl (NM_021669) Rat Tagged ORF Clone
RR201770 10 µg

Ghrl (NM_021669) Rat Tagged ORF Clone

Sign In for Pricing
View Details
MEOX2 (Mesenchyme Homeobox 2, GAX, MOX2) (MaxLight 490)
MBS6207373-01 0.1 mL

MEOX2 (Mesenchyme Homeobox 2, GAX, MOX2) (MaxLight 490)

Sign In for Pricing
View Details
MEOX2 (Mesenchyme Homeobox 2, GAX, MOX2) (MaxLight 490)
MBS6207373-02 5x 0.1 mL

MEOX2 (Mesenchyme Homeobox 2, GAX, MOX2) (MaxLight 490)

Sign In for Pricing
View Details
Cxcl16 Mouse Pre-designed siRNA Set A
HY-RS16693 1 Set

Cxcl16 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
DMEM (HG) With high glucose, L-glutamine and sodium pyruvate. W/O L-tyrosine and sodium bicarbonate.
DMP43-50LT 50 L

DMEM (HG) With high glucose, L-glutamine and sodium pyruvate. W/O L-tyrosine and sodium bicarbonate.

Sign In for Pricing
View Details