Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY)

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage T4 (Bacteriophage T4) . Target Name: uvsY. Accession Number: P04537. Expression Region: 1~137aa. Tag Info: N-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 21.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Enterobacteria phage T4 Recombination protein uvsY (uvsY) is a purified Recombinant Protein.

Accession Number

P04537

Expression Region

1~137aa

Host

E. coli

Target

UvsY

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Avi-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Enterobacteria phage T4 (Bacteriophage T4)

Protein Name

Recombinant Protein

AA Sequence

MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR134 Human qPCR Primer Pair (MI0000474)
HP300146 200 Reactions

MIR134 Human qPCR Primer Pair (MI0000474)

Sign In for Pricing
View Details
C.I. Mordant Orange 6
TRC-O467430-500MG 500 mg

C.I. Mordant Orange 6

Sign In for Pricing
View Details
Wnk3 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6247304 1.0 µg DNA

Wnk3 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse Protein TBRG4, Tbrg4 ELISA KIT
ELI-23764m 96 Tests

Mouse Protein TBRG4, Tbrg4 ELISA KIT

Sign In for Pricing
View Details
CD62L (gp90 MEL, hLHRc, L Selectin, L-Selectin, LSEL, Leukocyte Adhesion Molecule 1, LAM1, Leukocyte Endothelial Cell Adhesion Molecule 1, LECAM1, LECAM-1, Lymph Node Homing Receptor, LNHR, Lymphocyte Adhesion Molecule 1, LYAM1, PLNHR, Selectin L, SELL, TQ1) (FITC)
C2415-31H2 100 µg

CD62L (gp90 MEL, hLHRc, L Selectin, L-Selectin, LSEL, Leukocyte Adhesion Molecule 1, LAM1, Leukocyte Endothelial Cell Adhesion Molecule 1, LECAM1, LECAM-1, Lymph Node Homing Receptor, LNHR, Lymphocyte Adhesion Molecule 1, LYAM1, PLNHR, Selectin L, SELL, TQ1) (FITC)

Sign In for Pricing
View Details
TMPRSS11D Human Pre-designed siRNA Set A
HY-RS14765 1 Set

TMPRSS11D Human Pre-designed siRNA Set A

Sign In for Pricing
View Details