Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Fin bud initiation factor (fibin)

Recombinant Danio rerio Fin bud initiation factor (fibin) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Danio rerio (Zebrafish) (Brachydanio rerio) . Target Name: fibin. Accession Number: A1IGX5. Expression Region: 24~210aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Danio rerio Fin bud initiation factor (fibin) is a purified Recombinant Protein.

Accession Number

A1IGX5

Expression Region

24~210aa

Host

E. coli

Target

Fibin

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

26.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Zebrafish (Danio rerio; Brachydanio rerio)

Protein Name

Recombinant Protein

AA Sequence

FFAGPLYPEMSNGTFHHYFVPDGYYEENDDPEKCQMLFKMMDNRKCTLDEDQDSVIRDDFTIIKRHIEDAARVLEGIGKSISFDLDGEDSYGKYLRRETTQISEAFSNSEKSLLELEVKFKQSQENELKEEHKISDDFLNMIVHTRDVLKETLDISLGLKDKHELLSLIIRSHGTRLSRLKNDYMKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABHD10 Peptide - middle region (AAP68719)
AAP68719-100UG 100 µg

ABHD10 Peptide - middle region (AAP68719)

Sign In for Pricing
View Details
Mouse Claudin 20 (CLDN20) ELISA Kit
MBS9918327-01 48 Well

Mouse Claudin 20 (CLDN20) ELISA Kit

Sign In for Pricing
View Details
Mouse Claudin 20 (CLDN20) ELISA Kit
MBS9918327-02 96 Well

Mouse Claudin 20 (CLDN20) ELISA Kit

Sign In for Pricing
View Details
Mouse Claudin 20 (CLDN20) ELISA Kit
MBS9918327-03 5x 96 Well

Mouse Claudin 20 (CLDN20) ELISA Kit

Sign In for Pricing
View Details
Mouse Claudin 20 (CLDN20) ELISA Kit
MBS9918327-04 10x 96 Well

Mouse Claudin 20 (CLDN20) ELISA Kit

Sign In for Pricing
View Details
Prepro-Secretogranin II (527-566) (Human)
004-99 100 µg

Prepro-Secretogranin II (527-566) (Human)

Sign In for Pricing
View Details