Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-10 (TMSB10)

Recombinant Human Thymosin beta-10 (TMSB10) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TMSB10. Accession Number: P63313. Expression Region: 2~44aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 31.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Thymosin beta-10 (TMSB10) is a purified Recombinant Protein.

Accession Number

P63313

Expression Region

2~44aa

Host

E. coli

Target

TMSB10

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

31.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Homo sapiens (Human)

Protein Name

Recombinant Protein

AA Sequence

ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arl5b (NM_001015031) Rat Untagged Clone
RN214839 10 µg

Arl5b (NM_001015031) Rat Untagged Clone

Sign In for Pricing
View Details
Recombinant Human CD79B Protein, hFc-tagged, Alexa Fluor 647 conjugated
CD79B-239HAF647 20 μg- 50 μg- 100 μg

Recombinant Human CD79B Protein, hFc-tagged, Alexa Fluor 647 conjugated

Sign In for Pricing
View Details
EDA discontinued
388540 200 µL

EDA discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal Chordin Antibody [DyLight 755]
NBP2-98689IR 0.1 mL

Rabbit Polyclonal Chordin Antibody [DyLight 755]

Sign In for Pricing
View Details
NDRG1 Recombinant Antibody, RBITC Conjugated
bsm-61629R-RBITC-TR 20 µL

NDRG1 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
ErbB3 (ERBB3, v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 3 avian, HGNC:3431, ErbB-3, HER3, MDA-BF-1, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3) (BSA & Azide Free) (PE) discontinued
E3451-35EX-PE 100 µL

ErbB3 (ERBB3, v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 3 avian, HGNC:3431, ErbB-3, HER3, MDA-BF-1, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3) (BSA & Azide Free) (PE) discontinued

Sign In for Pricing
View Details