Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Golgi phosphoprotein 3 (GOLPH3)

Recombinant Human Golgi phosphoprotein 3 (GOLPH3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GOLPH3. Target Synonyms: Coat protein GPP34 (Mitochondrial DNA absence factor; MIDAS) . Accession Number: Q9H4A6. Expression Region: 1~298aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 39.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Golgi phosphoprotein 3 (GOLPH3) is a purified Recombinant Protein.

Accession Number

Q9H4A6

Expression Region

1~298aa

Host

E. coli

Target

GOLPH3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Coat protein GPP34 (Mitochondrial DNA absence factor; MIDAS)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Immunoglobulin superfamily, member 1 (IGSF1)
TRV-0007572-01 10 µg

Recombinant Immunoglobulin superfamily, member 1 (IGSF1)

Sign In for Pricing
View Details
Recombinant Immunoglobulin superfamily, member 1 (IGSF1)
TRV-0007572-02 50 µg

Recombinant Immunoglobulin superfamily, member 1 (IGSF1)

Sign In for Pricing
View Details
Recombinant Immunoglobulin superfamily, member 1 (IGSF1)
TRV-0007572-03 100 µg

Recombinant Immunoglobulin superfamily, member 1 (IGSF1)

Sign In for Pricing
View Details
Recombinant Immunoglobulin superfamily, member 1 (IGSF1)
TRV-0007572-04 200 µg

Recombinant Immunoglobulin superfamily, member 1 (IGSF1)

Sign In for Pricing
View Details
Recombinant Immunoglobulin superfamily, member 1 (IGSF1)
TRV-0007572-05 500 µg

Recombinant Immunoglobulin superfamily, member 1 (IGSF1)

Sign In for Pricing
View Details
Recombinant Immunoglobulin superfamily, member 1 (IGSF1)
TRV-0007572-06 1 mg

Recombinant Immunoglobulin superfamily, member 1 (IGSF1)

Sign In for Pricing
View Details