Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Golgi phosphoprotein 3 (GOLPH3)

Recombinant Human Golgi phosphoprotein 3 (GOLPH3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: GOLPH3. Target Synonyms: Coat protein GPP34 (Mitochondrial DNA absence factor; MIDAS) . Accession Number: Q9H4A6. Expression Region: 1~298aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 39.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Golgi phosphoprotein 3 (GOLPH3) is a purified Recombinant Protein.

Accession Number

Q9H4A6

Expression Region

1~298aa

Host

E. coli

Target

GOLPH3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Coat protein GPP34 (Mitochondrial DNA absence factor; MIDAS)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DES Antibody
GWB-C63FD3 0.1 mg

DES Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal to Human SLC25A19
MBS248331-01 0.2 mL

Rabbit Polyclonal to Human SLC25A19

Sign In for Pricing
View Details
Rabbit Polyclonal to Human SLC25A19
MBS248331-02 5x 0.2 mL

Rabbit Polyclonal to Human SLC25A19

Sign In for Pricing
View Details
Kip2, p57 (cdk Inhibitor, Cyclin Dependent Kinase Inhibitor) (BSA & Azide Free) (FITC) discontinued
K1851-01X-FITC 100 µL

Kip2, p57 (cdk Inhibitor, Cyclin Dependent Kinase Inhibitor) (BSA & Azide Free) (FITC) discontinued

Sign In for Pricing
View Details
MSN Polyclonal Antibody
E912463 100 µL

MSN Polyclonal Antibody

Sign In for Pricing
View Details
Tap1 Rabbit Polyclonal Antibody (BF555)
orb1598707 100 µL

Tap1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details