Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CBFA2T1 (RUNX1T1)

Recombinant Human Protein CBFA2T1 (RUNX1T1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RUNX1T1. Target Synonyms: Cyclin-D-related protein (Eight twenty one protein; Protein ETO; Protein MTG8; Zinc finger MYND domain-containing protein 2) . Accession Number: Q06455. Expression Region: 1~604aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 75kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Protein CBFA2T1 (RUNX1T1) is a purified Recombinant Protein.

Accession Number

Q06455

Expression Region

1~604aa

Host

E. coli

Target

RUNX1T1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

75kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cyclin-D-related protein (Eight twenty one protein; Protein ETO; Protein MTG8; Zinc finger MYND domain-containing protein 2)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLX3 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb890569 100 µL

TLX3 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
HighYield T7 ARCA mRNA Synthesis Kit (m5CTP), L pack
JBS-RNT-118-L 50 Reactions

HighYield T7 ARCA mRNA Synthesis Kit (m5CTP), L pack

Sign In for Pricing
View Details
Canine Ovarian cancer marker/Carbohydrate antigen 125 ELISA kit
GTR10393676 96 Well

Canine Ovarian cancer marker/Carbohydrate antigen 125 ELISA kit

Sign In for Pricing
View Details
Omp (Biotin)
570999-01 50 µL

Omp (Biotin)

Sign In for Pricing
View Details
Omp (Biotin)
570999-02 100 µL

Omp (Biotin)

Sign In for Pricing
View Details
Aristolactam BII
379617 5 mg

Aristolactam BII

Sign In for Pricing
View Details