Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CBFA2T1 (RUNX1T1)

Recombinant Human Protein CBFA2T1 (RUNX1T1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RUNX1T1. Target Synonyms: Cyclin-D-related protein (Eight twenty one protein; Protein ETO; Protein MTG8; Zinc finger MYND domain-containing protein 2) . Accession Number: Q06455. Expression Region: 1~604aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 75kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Protein CBFA2T1 (RUNX1T1) is a purified Recombinant Protein.

Accession Number

Q06455

Expression Region

1~604aa

Host

E. coli

Target

RUNX1T1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

75kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cyclin-D-related protein (Eight twenty one protein; Protein ETO; Protein MTG8; Zinc finger MYND domain-containing protein 2)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Anti-Smad Family Member 3 (SMAD3)
FY-AB42821-01 1 mL

Biotin-Linked Anti-Smad Family Member 3 (SMAD3)

Sign In for Pricing
View Details
Biotin-Linked Anti-Smad Family Member 3 (SMAD3)
FY-AB42821-02 100 µL

Biotin-Linked Anti-Smad Family Member 3 (SMAD3)

Sign In for Pricing
View Details
Biotin-Linked Anti-Smad Family Member 3 (SMAD3)
FY-AB42821-03 200 µL

Biotin-Linked Anti-Smad Family Member 3 (SMAD3)

Sign In for Pricing
View Details
FARP1 Protein Lysate
OCOA12450-20UG 20 µg

FARP1 Protein Lysate

Sign In for Pricing
View Details
HIV-1 p24 (Human Immunodeficiency Virus-1) (HRP)
MBS6480869-01 0.1 mL

HIV-1 p24 (Human Immunodeficiency Virus-1) (HRP)

Sign In for Pricing
View Details
HIV-1 p24 (Human Immunodeficiency Virus-1) (HRP)
MBS6480869-02 5x 0.1 mL

HIV-1 p24 (Human Immunodeficiency Virus-1) (HRP)

Sign In for Pricing
View Details