Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial

Recombinant Human Delta-like protein 3 (DLL3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: DLL3. Target Synonyms: Drosophila Delta homolog 3 (Delta3) . Accession Number: Q9NYJ7. Expression Region: 383~492aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 24.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Delta-like protein 3 (DLL3), partial is a purified Recombinant Protein.

Accession Number

Q9NYJ7

Expression Region

383~492aa

Host

E. coli

Target

DLL3

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

24.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Drosophila Delta homolog 3 (Delta3)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

FAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STFR M012-148x210-PP-CRD/1 AC Signs
819631 Card of 1 Pictogram(s)

STFR M012-148x210-PP-CRD/1 AC Signs

Sign In for Pricing
View Details
Cyclosporin A, >99%
BC020-105 5 g

Cyclosporin A, >99%

Sign In for Pricing
View Details
GUSBL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0922308 1.0 µg DNA

GUSBL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Goat Diamine Oxidase ELISA kit
GTR10462230 96 Well

Goat Diamine Oxidase ELISA kit

Sign In for Pricing
View Details
Human SH2B adapter protein 3 ELISA kit
GTR10416365 96 Well

Human SH2B adapter protein 3 ELISA kit

Sign In for Pricing
View Details
HRAS Protein Lysate (Rat) with C-HA Tag
23887036 100 µg

HRAS Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details