Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibronectin (FN1), partial

Recombinant Human Fibronectin (FN1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: FN1. Target Synonyms: Cold-insoluble globulin (CIG) . Accession Number: P02751. Expression Region: 732~911aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Fibronectin (FN1), partial is a purified Recombinant Protein.

Accession Number

P02751

Expression Region

732~911aa

Host

E. coli

Target

FN1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cancer

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial of the full length of 723-911AA

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cold-insoluble globulin (CIG)

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)
MBS1152926-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)
MBS1152926-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)
MBS1152926-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)
MBS1152926-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)
MBS1152926-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)
MBS1152926-06 0.02 mg (Mammalian-Cell)

Recombinant Staphylococcus aureus Putative Holliday junction resolvase (USA300HOU_1616)

Sign In for Pricing
View Details