Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterovirus A71 Genome polyprotein

Recombinant Enterovirus A71 Genome polyprotein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterovirus A71. Target Name: Enterovirus A71 Genome polyprotein. Target Synonyms: VP4-VP2 (P1A; Virion protein 4; Capsid protein VP2; P1B; Virion protein 2; P1C; Virion protein 3; P1D; Virion protein 1; Picornain 2A; Protein 2A; Protein 3B; P3B; 3D polymerase; 3Dpol; Protein 3D) . Accession Number: F6KTB0. Expression Region: 1441~1497aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 7.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Enterovirus A71 Genome polyprotein is a purified Recombinant Protein.

Accession Number

F6KTB0

Expression Region

1441~1497aa

Host

E. coli

Target

Enterovirus A71 Genome polyprotein

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

VP4-VP2 (P1A; Virion protein 4; Capsid protein VP2; P1B; Virion protein 2; P1C; Virion protein 3; P1D; Virion protein 1; Picornain 2A; Protein 2A; Protein 3B; P3B; 3D polymerase; 3Dpol; Protein 3D)

Species

Enterovirus A71

Protein Name

Recombinant Protein

AA Sequence

GPPKFKPIKISLEEKPAPDAISDLLASVDSEEVRQYCRDQGWIIPETPTNVERHLNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubxn1 siRNA Oligos set (Mouse)
49061174 3x 5 nmol

Ubxn1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Compound NP-022920
T128512-01 10 mg

Compound NP-022920

Sign In for Pricing
View Details
Compound NP-022920
T128512-02 1 g

Compound NP-022920

Sign In for Pricing
View Details
Compound NP-022920
T128512-03 1 mg

Compound NP-022920

Sign In for Pricing
View Details
Compound NP-022920
T128512-04 50 mg

Compound NP-022920

Sign In for Pricing
View Details
Compound NP-022920
T128512-05 5 mg

Compound NP-022920

Sign In for Pricing
View Details