Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLAM family member 6 (SLAMF6), partial

Recombinant Human SLAM family member 6 (SLAMF6), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SLAMF6. Target Synonyms: Activating NK receptor; NK-T-B-antigen; NTB-A. Accession Number: Q96DU3. Expression Region: 22~226aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human SLAM family member 6 (SLAMF6), partial is a purified Recombinant Protein.

Accession Number

Q96DU3

Expression Region

22~226aa

Host

E. coli

Target

SLAMF6

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activating NK receptor; NK-T-B-antigen; NTB-A

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stathmin 1 (Phospho-Ser15) Antibody Blocking Peptide
GWB-4A0FDD 0.1 mg

Stathmin 1 (Phospho-Ser15) Antibody Blocking Peptide

Sign In for Pricing
View Details
PNCA1 (PALLD, CGI151, FLJ22190, FLJ38193, FLJ39139, KIAA0992, Palladin, PALLD, PNCA1) (PE)
MBS6432061-01 0.1 mL

PNCA1 (PALLD, CGI151, FLJ22190, FLJ38193, FLJ39139, KIAA0992, Palladin, PALLD, PNCA1) (PE)

Sign In for Pricing
View Details
PNCA1 (PALLD, CGI151, FLJ22190, FLJ38193, FLJ39139, KIAA0992, Palladin, PALLD, PNCA1) (PE)
MBS6432061-02 5x 0.1 mL

PNCA1 (PALLD, CGI151, FLJ22190, FLJ38193, FLJ39139, KIAA0992, Palladin, PALLD, PNCA1) (PE)

Sign In for Pricing
View Details
CACNG6 (NM_145815) Human Tagged Lenti ORF Clone
RC217298L2 10 µg

CACNG6 (NM_145815) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human TOX (NP_055544) VersaClone cDNA
RDC2860 10 µg

Human TOX (NP_055544) VersaClone cDNA

Sign In for Pricing
View Details
FAS, phosphorylated (Tyr291) (Tumor Necrosis Factor Receptor Superfamily Member 6, FASLG Receptor, Apoptosis-mediating Surface Antigen FAS, Apo-1 Antigen, CD95, FAS, APT1, FAS1, TNFRSF6) (MaxLight 550) discontinued
F0019-59-ML550 100 µL

FAS, phosphorylated (Tyr291) (Tumor Necrosis Factor Receptor Superfamily Member 6, FASLG Receptor, Apoptosis-mediating Surface Antigen FAS, Apo-1 Antigen, CD95, FAS, APT1, FAS1, TNFRSF6) (MaxLight 550) discontinued

Sign In for Pricing
View Details