Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLAM family member 6 (SLAMF6), partial

Recombinant Human SLAM family member 6 (SLAMF6), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SLAMF6. Target Synonyms: Activating NK receptor; NK-T-B-antigen; NTB-A. Accession Number: Q96DU3. Expression Region: 22~226aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human SLAM family member 6 (SLAMF6), partial is a purified Recombinant Protein.

Accession Number

Q96DU3

Expression Region

22~226aa

Host

E. coli

Target

SLAMF6

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activating NK receptor; NK-T-B-antigen; NTB-A

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

QPCTL AAV Vector (Human) (CMV)
38267101 1 µg

QPCTL AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
TCP1 (T-complex 1, CCT1, CCTa, D6S230E, CCT-alpha, TCP-1-alpha) (MaxLight 650)
MBS6440199-01 0.1 mL

TCP1 (T-complex 1, CCT1, CCTa, D6S230E, CCT-alpha, TCP-1-alpha) (MaxLight 650)

Sign In for Pricing
View Details
TCP1 (T-complex 1, CCT1, CCTa, D6S230E, CCT-alpha, TCP-1-alpha) (MaxLight 650)
MBS6440199-02 5x 0.1 mL

TCP1 (T-complex 1, CCT1, CCTa, D6S230E, CCT-alpha, TCP-1-alpha) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Salmonella agona Bifunctional protein FolD (folD)
MBS1214087-01 0.02 mg (E-Coli)

Recombinant Salmonella agona Bifunctional protein FolD (folD)

Sign In for Pricing
View Details
Recombinant Salmonella agona Bifunctional protein FolD (folD)
MBS1214087-02 0.02 mg (Yeast)

Recombinant Salmonella agona Bifunctional protein FolD (folD)

Sign In for Pricing
View Details
Recombinant Salmonella agona Bifunctional protein FolD (folD)
MBS1214087-03 0.1 mg (E-Coli)

Recombinant Salmonella agona Bifunctional protein FolD (folD)

Sign In for Pricing
View Details