Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLAM family member 6 (SLAMF6), partial

Recombinant Human SLAM family member 6 (SLAMF6), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SLAMF6. Target Synonyms: Activating NK receptor; NK-T-B-antigen; NTB-A. Accession Number: Q96DU3. Expression Region: 22~226aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human SLAM family member 6 (SLAMF6), partial is a purified Recombinant Protein.

Accession Number

Q96DU3

Expression Region

22~226aa

Host

E. coli

Target

SLAMF6

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activating NK receptor; NK-T-B-antigen; NTB-A

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glt8d1 (NM_001007683) Rat Tagged ORF Clone Lentiviral Particle
RR207609L4V 200 µL

Glt8d1 (NM_001007683) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RCVRN sgRNA CRISPR Lentivector (Human) (Target 2)
K1804503 1.0 µg DNA

RCVRN sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Kdm3b qPCR Primer Pair
QM69454S 200 Tests

Mouse Kdm3b qPCR Primer Pair

Sign In for Pricing
View Details
ERBB2, phosphorylated (Y1127) (ERBB2, HER2, MLN19, NEU, NGL, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, p185erbB2, CD340) (MaxLight 650) discontinued
035181-ML650 100 µL

ERBB2, phosphorylated (Y1127) (ERBB2, HER2, MLN19, NEU, NGL, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, p185erbB2, CD340) (MaxLight 650) discontinued

Sign In for Pricing
View Details
IMPDH1 (NM_000883) Human Tagged Lenti ORF Clone
RC215206L3 10 µg

IMPDH1 (NM_000883) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat SGLT2 (Sodium/Glucose Cotransporter 2) ELISA Kit
ER21811 96 Tests

Rat SGLT2 (Sodium/Glucose Cotransporter 2) ELISA Kit

Sign In for Pricing
View Details