Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transcriptional enhancer factor TEF-3 (Tead4), partial

Recombinant Mouse Transcriptional enhancer factor TEF-3 (Tead4), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Tead4. Target Synonyms: ETF-related factor 2 (ETFR-2; TEA domain family member 4; TEAD-4; TEF-1-related factor 1; TEF-1-related factor FR-19; RTEF-1) . Accession Number: Q62296. Expression Region: 210~427aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 33.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Transcriptional enhancer factor TEF-3 (Tead4), partial is a purified Recombinant Protein.

Accession Number

Q62296

Expression Region

210~427aa

Host

E. coli

Target

Tead4

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ETF-related factor 2 (ETFR-2; TEA domain family member 4; TEAD-4; TEF-1-related factor 1; TEF-1-related factor FR-19; RTEF-1)

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM1 (Trafficking Protein Particle Complex 10, EHOC-1, EHOC1, FLJ54223, FLJ54817, FLJ55683, GT334, MGC126777, TMEM1, TRS130, TRS30) (MaxLight 490)
MBS6209080-01 0.1 mL

TMEM1 (Trafficking Protein Particle Complex 10, EHOC-1, EHOC1, FLJ54223, FLJ54817, FLJ55683, GT334, MGC126777, TMEM1, TRS130, TRS30) (MaxLight 490)

Sign In for Pricing
View Details
TMEM1 (Trafficking Protein Particle Complex 10, EHOC-1, EHOC1, FLJ54223, FLJ54817, FLJ55683, GT334, MGC126777, TMEM1, TRS130, TRS30) (MaxLight 490)
MBS6209080-02 5x 0.1 mL

TMEM1 (Trafficking Protein Particle Complex 10, EHOC-1, EHOC1, FLJ54223, FLJ54817, FLJ55683, GT334, MGC126777, TMEM1, TRS130, TRS30) (MaxLight 490)

Sign In for Pricing
View Details
Coronavirus, Nucleoprotein (SARS-CoV), Recombinant, His-Tag
532220 20 µg

Coronavirus, Nucleoprotein (SARS-CoV), Recombinant, His-Tag

Sign In for Pricing
View Details
UBE2V1 Rabbit pAb
E45R26421N-100 100 µL

UBE2V1 Rabbit pAb

Sign In for Pricing
View Details
Guinea Pig G Protein Coupled Receptor 48 ELISA kit
GTR10373334 96 Well

Guinea Pig G Protein Coupled Receptor 48 ELISA kit

Sign In for Pricing
View Details
GSC2 CRISPR Activation Plasmid (m2)
sc-431479-ACT-2 20 µg

GSC2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details