Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Alpha-1-acid glycoprotein (Orm1)

Recombinant Rat Alpha-1-acid glycoprotein (Orm1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Orm1. Target Synonyms: Orosomucoid; OMD. Accession Number: P02764. Expression Region: 19~205aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 25.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Alpha-1-acid glycoprotein (Orm1) is a purified Recombinant Protein.

Accession Number

P02764

Expression Region

19~205aa

Host

E. coli

Target

Orm1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Orosomucoid; OMD

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prokineticin 1 (PROK1) Human qPCR Primer Pair (NM_032414)
HP215935 200 Reactions

Prokineticin 1 (PROK1) Human qPCR Primer Pair (NM_032414)

Sign In for Pricing
View Details
TOB2P sgRNA CRISPR Lentivector (Human) (Target 1)
K2422302 1.0 µg DNA

TOB2P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Cd86 (NM_020081) Rat Tagged ORF Clone Lentiviral Particle
RR212012L3V 200 µL

Cd86 (NM_020081) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HCV Seroconversion Panel Donor# 66666 (13 X 1 mL)
HCV10011 13x 1 mL

HCV Seroconversion Panel Donor# 66666 (13 X 1 mL)

Sign In for Pricing
View Details
8-Br rG 200 nmol scale
27-6446-02 1 Each

8-Br rG 200 nmol scale

Sign In for Pricing
View Details
KRBA1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
25912064 1.0 µg DNA

KRBA1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details