Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 5 (CCL5)

Recombinant Human C-C motif chemokine 5 (CCL5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CCL5. Target Synonyms: EoCPEosinophil chemotactic cytokine; SIS-delta; Small-inducible cytokine A5T cell-specific protein P228; TCP228T-cell-specific protein RANTES. Accession Number: P13501. Expression Region: 24~91aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 11.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human C-C motif chemokine 5 (CCL5) is a purified Recombinant Protein.

Accession Number

P13501

Expression Region

24~91aa

Host

E. coli

Target

CCL5

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

EoCPEosinophil chemotactic cytokine; SIS-delta; Small-inducible cytokine A5T cell-specific protein P228; TCP228T-cell-specific protein RANTES

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-100 1x 100 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (B22.1 + B23.1), CF594 conjugate, 0.1mg/mL
BNC941221-500 1x 500 µL

Cytokeratin 8/18 (B22.1 + B23.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF594 conjugate, 0.1mg/mL
BNC942172-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/1120), CF647 conjugate, 0.1mg/mL
BNC471120-100 1x 100 µL

Ep-CAM / CD326 (EGP40/1120), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (TS1), CF740 conjugate, 0.1mg/mL
BNC740627-100 1x 100 µL

Cytokeratin 8 (TS1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details