Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Brevican core protein (Bcan), partial

Recombinant Rat Brevican core protein (Bcan), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Bcan. Target Synonyms: Brain-enriched hyaluronan-binding proteinBEHAB. Accession Number: P55068. Expression Region: 658~786aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 19kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Brevican core protein (Bcan), partial is a purified Recombinant Protein.

Accession Number

P55068

Expression Region

658~786aa

Host

Baculovirus

Target

Bcan

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell-Matrix Adhesion

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Brain-enriched hyaluronan-binding proteinBEHAB

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

DVGLHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CNRIP1 Protein, N-His
orb3060624-01 50 µg

Recombinant Human CNRIP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CNRIP1 Protein, N-His
orb3060624-02 100 µg

Recombinant Human CNRIP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CNRIP1 Protein, N-His
orb3060624-03 1 mg

Recombinant Human CNRIP1 Protein, N-His

Sign In for Pricing
View Details
ARFBP1, Control Peptide (HUWE1. HECT, UBA and WWE domain containing 1, ARF-binding protein 1, ARF-BP1, E3 ubiquitin-protein ligase HUWE1, HECT, UBA and WWE domain-containing protein 1, HectH9, HECTH9, Homologous to E6AP carboxyl terminus homologous protein 9, HSPC272, Ib772, KIAA0312, KIAA1578, Large structure of UREB1, LASU1, Mcl-1 ubiquitin ligase E3, Mule, MULE, Upstream regulatory element-binding protein 1, UREB1, URE-B1, URE-binding protein 1)
147137 50 µg

ARFBP1, Control Peptide (HUWE1. HECT, UBA and WWE domain containing 1, ARF-binding protein 1, ARF-BP1, E3 ubiquitin-protein ligase HUWE1, HECT, UBA and WWE domain-containing protein 1, HectH9, HECTH9, Homologous to E6AP carboxyl terminus homologous protein 9, HSPC272, Ib772, KIAA0312, KIAA1578, Large structure of UREB1, LASU1, Mcl-1 ubiquitin ligase E3, Mule, MULE, Upstream regulatory element-binding protein 1, UREB1, URE-B1, URE-binding protein 1)

Sign In for Pricing
View Details
Osteocrin Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-9566R-BF680 100 µL

Osteocrin Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Human C10orf90 Pre-designed siRNA Set B
SI001761B 1 Each

Human C10orf90 Pre-designed siRNA Set B

Sign In for Pricing
View Details