Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell division cycle protein 20 homolog (CDC20)

Recombinant Human Cell division cycle protein 20 homolog (CDC20) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CDC20. Target Synonyms: p55CDC. Accession Number: Q12834. Expression Region: 1~499aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 62.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Cell division cycle protein 20 homolog (CDC20) is a purified Recombinant Protein.

Accession Number

Q12834

Expression Region

1~499aa

Host

E. coli

Target

CDC20

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

62.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

P55CDC

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp2c12 Protein Vector (Rat) (pPM-C-His)
PV262805 500 ng

Cyp2c12 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Olfr545 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4144608 1.0 µg DNA

Olfr545 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Pde4dip Rat shRNA Plasmid (Locus ID 64183)
TL710677 1 Kit

Pde4dip Rat shRNA Plasmid (Locus ID 64183)

Sign In for Pricing
View Details
Recombinant Escherichia coli L-fucose isomerase (fucI)
MBS1241001-01 0.02 mg (E-Coli)

Recombinant Escherichia coli L-fucose isomerase (fucI)

Sign In for Pricing
View Details
Recombinant Escherichia coli L-fucose isomerase (fucI)
MBS1241001-02 0.02 mg (Yeast)

Recombinant Escherichia coli L-fucose isomerase (fucI)

Sign In for Pricing
View Details
Recombinant Escherichia coli L-fucose isomerase (fucI)
MBS1241001-03 0.1 mg (E-Coli)

Recombinant Escherichia coli L-fucose isomerase (fucI)

Sign In for Pricing
View Details