Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell division cycle protein 20 homolog (CDC20)

Recombinant Human Cell division cycle protein 20 homolog (CDC20) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CDC20. Target Synonyms: p55CDC. Accession Number: Q12834. Expression Region: 1~499aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 62.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Cell division cycle protein 20 homolog (CDC20) is a purified Recombinant Protein.

Accession Number

Q12834

Expression Region

1~499aa

Host

E. coli

Target

CDC20

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

62.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

P55CDC

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMILIN1 (DKFZp586M121, EMILIN-1, Elastin Microfibril Interface-located Protein 1, Elastin Microfibril Interfacer 1, EMI) (Biotin)
MBS6141719-01 0.1 mL

EMILIN1 (DKFZp586M121, EMILIN-1, Elastin Microfibril Interface-located Protein 1, Elastin Microfibril Interfacer 1, EMI) (Biotin)

Sign In for Pricing
View Details
EMILIN1 (DKFZp586M121, EMILIN-1, Elastin Microfibril Interface-located Protein 1, Elastin Microfibril Interfacer 1, EMI) (Biotin)
MBS6141719-02 5x 0.1 mL

EMILIN1 (DKFZp586M121, EMILIN-1, Elastin Microfibril Interface-located Protein 1, Elastin Microfibril Interfacer 1, EMI) (Biotin)

Sign In for Pricing
View Details
Recombinant Human SORCS3 Protein
E30P3058 20 µg

Recombinant Human SORCS3 Protein

Sign In for Pricing
View Details
ROR alpha (Nuclear Receptor ROR-alpha, Retinoid-related Orphan Receptor-alpha, Nuclear Receptor RZR-alpha, Nuclear Receptor Subfamily 1 Group F Member 1, NR1F1, RZRA, RORA) (MaxLight 550)
132726-ML550 100 µL

ROR alpha (Nuclear Receptor ROR-alpha, Retinoid-related Orphan Receptor-alpha, Nuclear Receptor RZR-alpha, Nuclear Receptor Subfamily 1 Group F Member 1, NR1F1, RZRA, RORA) (MaxLight 550)

Sign In for Pricing
View Details
Human Stromal cell derived factor 2 like 1 (SDF2L1) ELISA Kit
YP-W17972-01 48 Tests

Human Stromal cell derived factor 2 like 1 (SDF2L1) ELISA Kit

Sign In for Pricing
View Details
Human Stromal cell derived factor 2 like 1 (SDF2L1) ELISA Kit
YP-W17972-02 96 Tests

Human Stromal cell derived factor 2 like 1 (SDF2L1) ELISA Kit

Sign In for Pricing
View Details