Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD177 antigen (CD177), partial

Recombinant Human CD177 antigen (CD177), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD177. Target Synonyms: Human neutrophil alloantigen 2a; HNA-2a; NB1 glycoprotein; NB1 GP; Polycythemia rubra vera protein 1; PRV-1; CD177. Accession Number: Q8N6Q3. Expression Region: 22~321aa. Tag Info: N-Terminal 6Xhis-Gst-Tagged. Theoretical MW: 63.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human CD177 antigen (CD177), partial is a purified Recombinant Protein.

Accession Number

Q8N6Q3

Expression Region

22~321aa

Host

E. coli

Target

CD177

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Gst-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

63.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Human neutrophil alloantigen 2a; HNA-2a; NB1 glycoprotein; NB1 GP; Polycythemia rubra vera protein 1; PRV-1; CD177

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Taste receptor type 2 member 125 (TAS2R125) ELISA Kit
abx551055 96 Tests

Mouse Taste receptor type 2 member 125 (TAS2R125) ELISA Kit

Sign In for Pricing
View Details
Slc9a1 (NM_012652) Rat Tagged ORF Clone
RR209225 10 µg

Slc9a1 (NM_012652) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Tupaia chinensis IL31 Protein, C-Fc
E55P8362 50 µg

Recombinant Tupaia chinensis IL31 Protein, C-Fc

Sign In for Pricing
View Details
Fibcd1 Mouse shRNA Lentiviral Particle (Locus ID 98970)
TL516842V 500 µL Each

Fibcd1 Mouse shRNA Lentiviral Particle (Locus ID 98970)

Sign In for Pricing
View Details
Human CCL3L1 (Chemokine C-C-Motif Ligand 3 Like Protein 1) QuickTest ELISA Kit
MBS7619009-01 48 Well

Human CCL3L1 (Chemokine C-C-Motif Ligand 3 Like Protein 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human CCL3L1 (Chemokine C-C-Motif Ligand 3 Like Protein 1) QuickTest ELISA Kit
MBS7619009-02 96 Well

Human CCL3L1 (Chemokine C-C-Motif Ligand 3 Like Protein 1) QuickTest ELISA Kit

Sign In for Pricing
View Details