Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement component C8 beta chain (C8B)

Recombinant Human Complement component C8 beta chain (C8B) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: C8B. Target Synonyms: Complement component 8 subunit beta. Accession Number: P07358. Expression Region: 55~591aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 67.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Complement component C8 beta chain (C8B) is a purified Recombinant Protein.

Accession Number

P07358

Expression Region

55~591aa

Host

E. coli

Target

C8B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

67.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Complement component 8 subunit beta

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21WAF1 (Tumor Suppressor Protein) (rCIP1/823), CF488A conjugate, 0.1mg/mL
BNC882292-100 1x 100 µL

P21WAF1 (Tumor Suppressor Protein) (rCIP1/823), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GENLISA Human Laboratory Testing Revealed Lymphocytic Choriomeningitis Virus Antibody (LCMV-Ab) ELISA
KBH12534 1x 96 Well

GENLISA Human Laboratory Testing Revealed Lymphocytic Choriomeningitis Virus Antibody (LCMV-Ab) ELISA

Sign In for Pricing
View Details
pET30a-ZNF24 Plasmid
PVT19935 2 µg

pET30a-ZNF24 Plasmid

Sign In for Pricing
View Details
MegaFi Fidelity DNA Polymerase
E36G896 400 Reactions (200 µL)

MegaFi Fidelity DNA Polymerase

Sign In for Pricing
View Details
Recombinant Chicken Amidophosphoribosyltransferase (PPAT)
MBS964512-01 0.02 mg (E-Coli)

Recombinant Chicken Amidophosphoribosyltransferase (PPAT)

Sign In for Pricing
View Details
Recombinant Chicken Amidophosphoribosyltransferase (PPAT)
MBS964512-02 0.02 mg (Yeast)

Recombinant Chicken Amidophosphoribosyltransferase (PPAT)

Sign In for Pricing
View Details