Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement component C8 beta chain (C8B)

Recombinant Human Complement component C8 beta chain (C8B) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: C8B. Target Synonyms: Complement component 8 subunit beta. Accession Number: P07358. Expression Region: 55~591aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 67.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Complement component C8 beta chain (C8B) is a purified Recombinant Protein.

Accession Number

P07358

Expression Region

55~591aa

Host

E. coli

Target

C8B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

67.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Complement component 8 subunit beta

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPP9 Rabbit Polyclonal Antibody
orb585866 100 µL

DPP9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Guinea Pig Adipose Triglyceride Lipase, ATGL ELISA Kit
MBS7257433-01 48 Well

Guinea Pig Adipose Triglyceride Lipase, ATGL ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Adipose Triglyceride Lipase, ATGL ELISA Kit
MBS7257433-02 96 Well

Guinea Pig Adipose Triglyceride Lipase, ATGL ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Adipose Triglyceride Lipase, ATGL ELISA Kit
MBS7257433-03 5x 96 Well

Guinea Pig Adipose Triglyceride Lipase, ATGL ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Adipose Triglyceride Lipase, ATGL ELISA Kit
MBS7257433-04 10x 96 Well

Guinea Pig Adipose Triglyceride Lipase, ATGL ELISA Kit

Sign In for Pricing
View Details
RSPO4 siRNA (Mouse)
orb1836612-01 15 nmol

RSPO4 siRNA (Mouse)

Sign In for Pricing
View Details