Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UPF0565 protein C2orf69 (C2orf69)

Recombinant Human UPF0565 protein C2orf69 (C2orf69) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: C2orf69. Accession Number: Q8N8R5. Expression Region: 25~385aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 46.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human UPF0565 protein C2orf69 (C2orf69) is a purified Recombinant Protein.

Accession Number

Q8N8R5

Expression Region

25~385aa

Host

E. coli

Target

C2orf69

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SSCSQARTMNPGGSGGARCSLSAEVRRRQCLQLSTVPGADPQRSNELLLLAAAGEGLERQDLPGDPAKEEPQPPPQHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHNTDFGAFKHLYMLLVNAFNLSQNSLSKKSLNVWNKDSIASNCRSSPSHTTNGCQGEKVRTCEKSDESAMSFYPPSLNDASFTLIGFSKGCVVLNQLLFELKEAKKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLKEFAQTGIIVHTHVTPYQVRDPMRSWIGKEHKKFVQILGDLGMQVTSQIHFTKEAPSIENHFRVHEVF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces Cerevisiae RRG8 Protein (aa 1-277) [His] (strain Lalvin EC1118 / Prise de mousse)
VAng-Wyb5649-1mg 1 mg

Recombinant Saccharomyces Cerevisiae RRG8 Protein (aa 1-277) [His] (strain Lalvin EC1118 / Prise de mousse)

Sign In for Pricing
View Details
CCDC172 (NM_198515) Human Mass Spec Standard
PH306700 10 µg

CCDC172 (NM_198515) Human Mass Spec Standard

Sign In for Pricing
View Details
PGBD1 (NM_032507) Human Tagged ORF Clone
RG223042 10 µg

PGBD1 (NM_032507) Human Tagged ORF Clone

Sign In for Pricing
View Details
Glycine Separopore® 4B
20181065-2 10 mL

Glycine Separopore® 4B

Sign In for Pricing
View Details
Newcastle Disease Virus (NDV) (APC)
N2275-01-APC 100 µL

Newcastle Disease Virus (NDV) (APC)

Sign In for Pricing
View Details
Rabbit Polyclonal West Nile Virus Protein E Antibody [DyLight 405]
NBP3-06464V 0.1 mL

Rabbit Polyclonal West Nile Virus Protein E Antibody [DyLight 405]

Sign In for Pricing
View Details