Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UPF0565 protein C2orf69 (C2orf69)

Recombinant Human UPF0565 protein C2orf69 (C2orf69) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: C2orf69. Accession Number: Q8N8R5. Expression Region: 25~385aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 46.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human UPF0565 protein C2orf69 (C2orf69) is a purified Recombinant Protein.

Accession Number

Q8N8R5

Expression Region

25~385aa

Host

E. coli

Target

C2orf69

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

46.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

SSCSQARTMNPGGSGGARCSLSAEVRRRQCLQLSTVPGADPQRSNELLLLAAAGEGLERQDLPGDPAKEEPQPPPQHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENVATILAHRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHNTDFGAFKHLYMLLVNAFNLSQNSLSKKSLNVWNKDSIASNCRSSPSHTTNGCQGEKVRTCEKSDESAMSFYPPSLNDASFTLIGFSKGCVVLNQLLFELKEAKKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLKEFAQTGIIVHTHVTPYQVRDPMRSWIGKEHKKFVQILGDLGMQVTSQIHFTKEAPSIENHFRVHEVF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4E2 siRNA (Human)
MBS828949-01 15 nmol

EIF4E2 siRNA (Human)

Sign In for Pricing
View Details
EIF4E2 siRNA (Human)
MBS828949-02 30 nmol

EIF4E2 siRNA (Human)

Sign In for Pricing
View Details
EIF4E2 siRNA (Human)
MBS828949-03 5x 30 nmol

EIF4E2 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Azobacteroides pseudotrichonymphae genomovar. CFP2 Elongation factor Ts (tsf)
MBS1234111-01 0.02 mg (E-Coli)

Recombinant Azobacteroides pseudotrichonymphae genomovar. CFP2 Elongation factor Ts (tsf)

Sign In for Pricing
View Details
Recombinant Azobacteroides pseudotrichonymphae genomovar. CFP2 Elongation factor Ts (tsf)
MBS1234111-02 0.02 mg (Yeast)

Recombinant Azobacteroides pseudotrichonymphae genomovar. CFP2 Elongation factor Ts (tsf)

Sign In for Pricing
View Details
Recombinant Azobacteroides pseudotrichonymphae genomovar. CFP2 Elongation factor Ts (tsf)
MBS1234111-03 0.1 mg (E-Coli)

Recombinant Azobacteroides pseudotrichonymphae genomovar. CFP2 Elongation factor Ts (tsf)

Sign In for Pricing
View Details