Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement component C8 alpha chain (C8A), partial

Recombinant Human Complement component C8 alpha chain (C8A), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: C8A. Target Synonyms: Complement component 8 subunit alpha. Accession Number: P07357. Expression Region: 31~584aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 65.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Complement component C8 alpha chain (C8A), partial is a purified Recombinant Protein.

Accession Number

P07357

Expression Region

31~584aa

Host

E. coli

Target

C8A

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

65.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Complement component 8 subunit alpha

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDIISRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hypothemycin 10mg
A13750-10 10 mg

Hypothemycin 10mg

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0059 membrane protein yebN (yebN)
MBS1119071 Inquire

Recombinant Escherichia coli UPF0059 membrane protein yebN (yebN)

Sign In for Pricing
View Details
HNF4A Protein Lysate (Mouse) with C-HA Tag
23695034 100 µg

HNF4A Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Cldn3 ORF Vector (Mouse) (pORF)
16283014 1.0 µg DNA

Cldn3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal B4GALT6 Antibody [Alexa Fluor 647]
NBP2-99252AF647 0.1 mL

Rabbit Polyclonal B4GALT6 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
TRPC4 siRNA (S. scrofa)
sc-270470 10 µM

TRPC4 siRNA (S. scrofa)

Sign In for Pricing
View Details