Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement component C8 alpha chain (C8A), partial

Recombinant Human Complement component C8 alpha chain (C8A), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: C8A. Target Synonyms: Complement component 8 subunit alpha. Accession Number: P07357. Expression Region: 31~584aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 65.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Complement component C8 alpha chain (C8A), partial is a purified Recombinant Protein.

Accession Number

P07357

Expression Region

31~584aa

Host

E. coli

Target

C8A

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

65.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Complement component 8 subunit alpha

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDIISRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MANSC1 Protein Vector (Mouse) (pPM-C-HA)
27998024 500 ng

MANSC1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Guinea Pig A Disintegrin And Metalloprotease 9 ELISA kit
GTR10451964 96 Well

Guinea Pig A Disintegrin And Metalloprotease 9 ELISA kit

Sign In for Pricing
View Details
Rabbit Polyclonal Ancient ubiquitous protein 1 Antibody [DyLight 755]
NBP3-06403IR 0.1 mL

Rabbit Polyclonal Ancient ubiquitous protein 1 Antibody [DyLight 755]

Sign In for Pricing
View Details
Pick1 3'UTR Lenti-reporter-Luc Vector
36638086 1.0 µg

Pick1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Fam177a Recombinant Protein (Mouse)
RP133178 100 µg

Fam177a Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human Liver Ductal Organoid Growth Medium (Expansion)
CM1027-100 100 mL

Human Liver Ductal Organoid Growth Medium (Expansion)

Sign In for Pricing
View Details