Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Candidapepsin-6 (SAP6)

Recombinant Candida albicans Candidapepsin-6 (SAP6) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Candida albicans (Yeast) . Target Name: SAP6. Target Synonyms: ACP 6; Aspartate protease 6; Secreted aspartic protease 6. Accession Number: P43095. Expression Region: 77~418aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 39.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Candida albicans Candidapepsin-6 (SAP6) is a purified Recombinant Protein.

Accession Number

P43095

Expression Region

77~418aa

Host

E. coli

Target

SAP6

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ACP 6; Aspartate protease 6; Secreted aspartic protease 6

Species

Candida albicans (Yeast)

Protein Name

Recombinant Protein

AA Sequence

GPVAVKLDNEIITYSADITVGSNNQKLSVIVDTGSSDLWIPDSKAICIPKWRGDCGDFCKNNGSYSPAASSTSKNLNTRFEIKYADGSYAKGNLYQDTVGIGGASVKNQLFANVWSTSAHKGILGIGFQTNEATRTPYDNLPISLKKQGIIAKNAYSLFLNSPEASSGQIIFGGIDKAKYSGSLVELPITSDRTLSVGLRSVNVMGRNVNVNAGVLLDSGTTISYFTPSIARSIIYALGGQVHFDSAGNKAYVADCKTSGTVDFQFDKNLKISVPASEFLYQLYYTNGKPYPKCEIRVRESEDNILGDNFMRSAYIVYDLDDKKISMAQVKYTSESNIVAIN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Tyrosine Kinase 2 (Tyk-2) ELISA Kit
NSL0047Po 96 Tests

Porcine Tyrosine Kinase 2 (Tyk-2) ELISA Kit

Request Quote
View Details
MMP1 (NM_002421) Human Tagged Lenti ORF Clone
RC202460L3 10 µg

MMP1 (NM_002421) Human Tagged Lenti ORF Clone

Request Quote
View Details
IDO1 Mouse Monoclonal Antibody [Clone ID: LBI2A10]
AMM13806VCF 100 µg

IDO1 Mouse Monoclonal Antibody [Clone ID: LBI2A10]

Request Quote
View Details
SNRPD2 Polyclonal Antibody
MBS9431862-01 0.05 mL

SNRPD2 Polyclonal Antibody

Request Quote
View Details
SNRPD2 Polyclonal Antibody
MBS9431862-02 0.1 mL

SNRPD2 Polyclonal Antibody

Request Quote
View Details
SNRPD2 Polyclonal Antibody
MBS9431862-03 5x 0.1 mL

SNRPD2 Polyclonal Antibody

Request Quote
View Details