Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytokine-like protein 1 (CYTL1)

Recombinant Human Cytokine-like protein 1 (CYTL1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CYTL1. Target Synonyms: Protein C17. Accession Number: Q9NRR1. Expression Region: 23~136aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Cytokine-like protein 1 (CYTL1) is a purified Recombinant Protein.

Accession Number

Q9NRR1

Expression Region

23~136aa

Host

E. coli

Target

CYTL1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein C17

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-500 1x 500 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF568 conjugate, 0.1mg/mL
BNC682040-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF640R conjugate, 0.1mg/mL
BNC402067-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (rCDH1/1525), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details