Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytokine-like protein 1 (CYTL1)

Recombinant Human Cytokine-like protein 1 (CYTL1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CYTL1. Target Synonyms: Protein C17. Accession Number: Q9NRR1. Expression Region: 23~136aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 20.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Cytokine-like protein 1 (CYTL1) is a purified Recombinant Protein.

Accession Number

Q9NRR1

Expression Region

23~136aa

Host

E. coli

Target

CYTL1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein C17

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Poly-beta-1,6-N-acetyl-D-glucosamine synthase (pgaC), partial
MBS7058467 Inquire

Recombinant Escherichia coli Poly-beta-1,6-N-acetyl-D-glucosamine synthase (pgaC), partial

Sign In for Pricing
View Details
25 Antibody
MBS7162477 Inquire

25 Antibody

Sign In for Pricing
View Details
Anti-Human LTbR (Lymphotoxin beta Receptor) Antibody
MBS4159622-01 0.1 mL

Anti-Human LTbR (Lymphotoxin beta Receptor) Antibody

Sign In for Pricing
View Details
Anti-Human LTbR (Lymphotoxin beta Receptor) Antibody
MBS4159622-02 5x 0.1 mL

Anti-Human LTbR (Lymphotoxin beta Receptor) Antibody

Sign In for Pricing
View Details
ODF2L Peptide - middle region
MBS3237558-01 0.1 mg

ODF2L Peptide - middle region

Sign In for Pricing
View Details
ODF2L Peptide - middle region
MBS3237558-02 5x 0.1 mg

ODF2L Peptide - middle region

Sign In for Pricing
View Details