Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G), partial

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: HLA-G. Target Synonyms: HLA G antigen; MHC class I antigen G. Accession Number: P17693. Expression Region: 25~308aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 47.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G), partial is a purified Recombinant Protein.

Accession Number

P17693

Expression Region

25~308aa

Host

E. coli

Target

HLA-G

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-B2M-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

HLA G antigen; MHC class I antigen G

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parathyroid Hormone (PTH) (N-Terminal), 0.2mg/mL
BNUB1728-500 1x 500 µL

Parathyroid Hormone (PTH) (N-Terminal), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS633000 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
4-Aminophenyl 2-Acetamido-2-deoxy-Alpha-D-galactopyranoside Hydrochloride
TRC-A622000-25MG 25 mg

4-Aminophenyl 2-Acetamido-2-deoxy-Alpha-D-galactopyranoside Hydrochloride

Sign In for Pricing
View Details
Glutathione Peroxidase 1 (GPX1) Human Gene Knockout Kit (CRISPR)
KN400729 1 Kit

Glutathione Peroxidase 1 (GPX1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PKC alpha (PRKCA) Mouse Monoclonal Antibody [Clone ID: OTI5F4]
TA813398 100 µL

PKC alpha (PRKCA) Mouse Monoclonal Antibody [Clone ID: OTI5F4]

Sign In for Pricing
View Details
Human IL17RA Antibody Pair Set
E-KAB-0494 50 µL & 100 µg

Human IL17RA Antibody Pair Set

Sign In for Pricing
View Details