Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

Recombinant Influenza A virus Matrix protein 2 (M2) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Influenza A virus. Target Name: M2. Target Synonyms: Proton channel protein M2. Accession Number: A0A2R3YRM7. Expression Region: 1~97aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Influenza A virus Matrix protein 2 (M2) is a purified CF Transmembrane Protein.

Accession Number

A0A2R3YRM7

Expression Region

1~97aa

Host

E. coli

Target

M2

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Proton channel protein M2

Species

Influenza A virus

Protein Name

CF Transmembrane Protein

AA Sequence

MSLLTEVETPTRSGWECRCSDSSDPLVIAANIIGILHLILWITDRLFFKCIYRRFKYGLKRGPSTEGVPESMREEYQQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCR2 Mouse Monoclonal Antibody [Clone ID: OTI4B8]
TA809536S 30 µL

NCR2 Mouse Monoclonal Antibody [Clone ID: OTI4B8]

Sign In for Pricing
View Details
CD283 Antibody
GWB-FE23B8 0.1 mg

CD283 Antibody

Sign In for Pricing
View Details
Lentiviral human MSGN1 shRNA (UAS) - Lentiviral human MSGN1 shRNA (UAS, GFP) (25)
GTR15139256 1 Vial

Lentiviral human MSGN1 shRNA (UAS) - Lentiviral human MSGN1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
PLD1 3'UTR Luciferase Stable Cell Line
TU018223 1.0 mL

PLD1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SLC38A4 Rabbit Polyclonal Antibody
orb578502 100 µL

SLC38A4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Bromoimidazo[1,2-a]pyridine-2-carboxylic acid
OR926154-01 250 mg

5-Bromoimidazo[1,2-a]pyridine-2-carboxylic acid

Sign In for Pricing
View Details